General Information

  • ID:  hor006037
  • Uniprot ID:  Q5GC91
  • Protein name:  Maximin-S4
  • Gene name:  NA
  • Organism:  Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad)
  • Family:  Maximin-S family
  • Source:  Animal
  • Expression:  Expressed by the skin dorsal glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0042742 defense response to bacterium
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSNKGFNFMVDMIQALSK
  • Length:  18(206-223)
  • Propeptide:  MNFNYFILVLFFITSGHAKSETREVHQEAENHIKRGSNTGFNFKTLDKEKRSAEEQNLAEHLVTRGSNKGFNFMVDMINALSNGKRSAEEQDLAEDLVTRGSNKGFNFMVDMIQALSKGKRSAEDQDLAEDLVTRGSNKGFNFMVDMIQALSNGKRSAEEQDLAEHLVTRGSNKGFNFMVDMINALSNGKRSAEEQDLVEDLVTRRSNKGFNFMVDMIQALSKGKRSAEEQDLAEDLVTRGSNKGFNFMVDMIQA
  • Signal peptide:  MNFNYFILVLFFITSGHA
  • Modification:  T18 Lysine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Maximin-S1 has no antimicrobial activity. Has no hemolytic activity.; Maximin-S2 has an activity against mycoplasma but has no activity against common Gram-positive and Gram-negative bacteria nor fungi. Has no hemolytic activity (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5GC91-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006037_AF2.pdbhor006037_ESM.pdb

Physical Information

Mass: 238986 Formula: C91H148N26O26S2
Absent amino acids: CEHPTWY Common amino acids: FKMNS
pI: 10.79 Basic residues: 3
Polar residues: 5 Hydrophobic residues: 6
Hydrophobicity: -25.56 Boman Index: -3307
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 65
Instability Index: 2559.44 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15649437
  • Title:  Maximins S, a novel group of antimicrobial peptides from toad Bombina maxima.